PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0051100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bHLH
Protein Properties Length: 92aa    MW: 10392.7 Da    PI: 7.3656
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0051100.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH21.73.6e-0720591554
                       HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                       +i +  ++L++llP+a   ++ ++  + +L+++++YI+sL
  ORGLA03G0051100.1 20 QISDLVSKLQDLLPEARLRSNDRVPSSRVLQETCNYIRSL 59
                       789999*********8899*******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.102.3E-8478IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS508889.813559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474595.63E-91981IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.6E-42059IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MSSRRSRSRQ SGSSRITDEQ ISDLVSKLQD LLPEARLRSN DRVPSSRVLQ ETCNYIRSLH  60
QEVDDLSERL SELLATSDMS SAQAAIIRSL LM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0695691e-155AK069569.1 Oryza sativa Japonica Group cDNA clone:J023022K12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629922.14e-57PREDICTED: transcription factor ILI6 isoform X4
SwissprotB8APB55e-59ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR25e-59ILI6_ORYSJ; Transcription factor ILI6
TrEMBLA0A0D3FEE44e-57A0A0D3FEE4_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0CVV14e-57A0A0E0CVV1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GHG84e-57A0A0E0GHG8_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NQC54e-57A0A0E0NQC5_ORYRU; Uncharacterized protein
TrEMBLI1P8154e-57I1P815_ORYGL; Uncharacterized protein
STRINGBGIOSGA011363-PA1e-56(Oryza sativa Indica Group)
STRINGORGLA03G0051100.11e-56(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.16e-34bHLH family protein